PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010550510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 192aa    MW: 21721.5 Da    PI: 10.2177
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010550510.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.23.8e-13126170347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+e+++ + +++G+g+W++I+r    ++t+ q+ s+ qky
   XP_010550510.1 126 PWTKEEHEQFLIGLEKYGKGDWRSISRQCVMTKTPIQIASHAQKY 170
                      8**************************99989************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-11116175IPR009057Homeodomain-like
PROSITE profilePS5129418.81119175IPR017930Myb domain
SuperFamilySSF466893.89E-17120176IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-16122173IPR006447Myb domain, plants
SMARTSM007171.5E-8123173IPR001005SANT/Myb domain
CDDcd001671.43E-8126171No hitNo description
PfamPF002491.0E-10126170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MSESRGAVLA MINARYLRGN DIPEWSWNEN KTFENAIAAA AAAVDADNSF SDIVGEISSR  60
FSGKTKQQIQ MHLDALIEDI RTIEHGLIPL PDYGDSGSTI RQNSGDRWRT TAAAIKHKHH  120
RKKAVPWTKE EHEQFLIGLE KYGKGDWRSI SRQCVMTKTP IQIASHAQKY FLRLKRNSAT  180
RTSQIRSNSN LN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010550510.11e-143PREDICTED: transcription factor DIVARICATA-like
TrEMBLB9HH207e-46B9HH20_POPTR; Uncharacterized protein
STRINGPOPTR_0007s08530.12e-45(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2062545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.13e-31MYB family protein